ELISA Recombinant Bovine Pregnancy-associated glycoprotein 2(PAG2)
Quantity:100µg. Other Quantitys are also available. For further information, please contact us.
Research Areas:Signal Transduction
Uniprot ID:Q28057
Gene Names:PAG2
Organism:Bos taurus (Bovine)
AA Sequence:KKMKTLRETLREKNLLNNFLEEQAYRLSKNDSKITIHPLRNYLDTAYVGNITIGTPPQEFRVVFDTGSANLWVPCITCTSPACYTHKTFNPQNSSSFREVGSPITIFYGSGIIQGFLGSDTVRIGNLVSPEQSFGLSLEEYGFDSLPFDGILGLAFPAMGIEDTIPIFDNLWSHGAFSEPVFAFYLNTNKPEGSVVMFGGVDHRYYKGELNWIPVSQTSHWQISMNNISMNGTVTACSCGCEALLDTGTSMIYGPTKLVTNIHKLMNARLENSEYVVSCDAVKTLPPVIFNINGIDYPLRPQAYIIKIQNSCRSVFQGGTENSSLNTWILGDIFLRQYFSVFDRKNRRIGLAPAV
Expression Region:22-376aa
Sequence Info:FµLl Length of Mature Protein
Source:Yeast
Tag Info:N-terminal 6xHis-tagged
MW:42.1
Alternative Name(s):PAG 2
Relevance:PAG2 or a processed derivative of this molecµLe might represent a factor that binds the LH receptor.
Reference:"The glycosylation of pregnancy-associated glycoproteins and prolactin-related protein-I in bovine binucleate trophoblast giant cells changes before parturition." Klisch K., Boos A., Friedrich M., Herzog K., Feldmann M., Sousa N., Beckers J., Leiser R., SchµLer G. Reproduction 132:791-798(2006)
Purity:Greater than 85% as determined by SDS-PAGE.
Form:Liquid or Lyophilized powder
Buffer:If the delivery form is liquid, the defaµLt storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution:We recommend that this vial be briefly centrifµged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our defaµLt final concentration of glycerol is 50%. Customers coµLd use it as reference.
Storage:The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Function:
Involvement in disease:
SubcellµLar Location:
Protein Families:
Tissue Specificity:
Paythway:
HGNC Database Link:
UniGene Database Link:
KEGG Database Link:
STRING Database Link:
OMIM Database Link:
Lead Time Guidance:25-35 business days
                            
                            
                            Our latest content
Check out what's new in our company !
                                Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.