Skip to Content

ELISA Recombinant Bovine Odorant-binding protein

Quantity: 200µg. Other Quantitys are also available. Please Inquire. In Stock: No Lead time: 22-32 working days Research Topic: Others Uniprot ID: P07435 Gene Names: N/A Organism: Bos taurus (Bovine) AA Sequence: AQEEEAEQNLSELSGPWRTVYIGSTNPEKIQENGPFRTYFRELVFDDEKGTVDFYFSVKRDGKWKNVHVKATKQDDGTYVADYEGQNVFKIVSLSRTHLVAHNINVDKHGQTTELTELFVKLNVEDEDLEKFWKLTEDKGIDKKNVVNFLENEDHPHPE Expression Region: 1-159aa Sequence Info: FµLl Length Source: Yeast Tag Info: N-terminal 10xHis-tagged MW: 21 kDa Alternative Name(s): Olfactory mucosa pyrazine-binding protein Relevance: This protein binds a wide variety of chemical odorants. Reference: "Three-dimensional structure and active site of three hydrophobic molecµLe-binding proteins with significant amino acid sequence similarity." Monaco H.L., Zanotti G. Biopolymers 32:457-465(1992) Purity: Greater than 85% as determined by SDS-PAGE. Storage Buffer: Tris-based buffer,50% glycerol Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
1.00 € 1.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days

Our latest content

Check out what's new in our company !

Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.