Skip to Content

ELISA Recombinant Bovine Interferon alpha-G(IFNAG)

Quantity: 200µg. Other Quantitys are also available. Please Inquire. In Stock: No Lead time: 22-32 working days Research Topic: Others Uniprot ID: P49877 Gene Names: IFNAG Organism: Bos taurus (Bovine) AA Sequence: CHLPHTHSLANRRVLTLLRQLRRVSPSSCLQDRNDFAFPQEALGGSQLQKAQAISVLHEVTQHTFQFFSVEGSAVVWDESLLDKLRDALDQQLTDLQFCLRQEEGLRGAPLLKEDSSLAVRKYFHRLTLYLQEKRHSPCAWEVVRAEVMRAFSSSTNLQERFRRKD Expression Region: 24-189aa Sequence Info: FµLl Length Source: Yeast Tag Info: N-terminal 6xHis-tagged MW: 21.2 kDa Alternative Name(s): IFN-alpha7 Relevance: Produced by macrophages, IFN-alpha have antiviral activities. Interferon stimµLates the production of two enzymes: a protein kinase and an oligoadenylate synthetase. Reference: "The cloning of cattle interferon-A subtypes isolated from the gut epithelium of rotavirus-infected calves."Chaplin P.J., Parsons K.R., Collins B.A.Immunogenetics 44:143-145(1996) Purity: Greater than 90% as determined by SDS-PAGE. Storage Buffer: Tris-based buffer,50% glycerol Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
1.00 € 1.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days

Our latest content

Check out what's new in our company !

Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.