ELISA Recombinant Bovine T-cell surface glycoprotein CD8 alpha chain(CD8A),partial
Quantity: 200µg. Other Quantitys are also available. Please Inquire.
In Stock: No
Lead time: 22-32 working days
Research Topic: Immunology
Uniprot ID: P31783
Gene Names: CD8A
Organism: Bos taurus (Bovine)
AA Sequence: LSFRMSPTQKETRLGEKVELQCELLQSGMATGCSWLRHIPGDDPRPTFLMYLSAQRVKLAEGLDPRHISGAKVSGTKFQLTLSSFLQEDQGYYFCSVVSNSILYFSNFVPVFLPAKPATTPAMRPSSAAPTSAPQTRSVSPRSEVCRTSAGSAVDTSRLDFACN
Expression Region: 26-189aa
Sequence Info: ExtracellµLar Domain
Source: Yeast
Tag Info: N-terminal 6xHis-tagged
MW: 19.9 kDa
Alternative Name(s): CD_antigen: CD8a
Relevance: Identifies cytotoxic/suppressor T-cells that interact with MHC class I bearing targets. CD8 is thoµght to play a role in the process of T-cell mediated killing. CD8 alpha chains binds to class I MHC molecµLes alpha-3 domains.
Reference: "MolecµLar cloning, reconstruction and expression of the gene encoding the alpha-chain of the bovine CD8 -- definition of three peptide regions conserved across species."Lalor P., Bucci C., Fornaro M., Rattazzi M.C., Nakauchi H., Herzenberg L.A., Alberti S.Immunology 76:95-102(1992)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer,50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
                            
                            
                            Our latest content
Check out what's new in our company !
                                Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.