ELISA Recombinant Bovine Apolipoprotein A-I(APOA1)

Quantity: 200µg. Other Quantitys are also available. Please Inquire. In Stock: No Lead time: 22-32 working days Research Topic: Others Uniprot ID: P15497 Gene Names: APOA1 Organism: Bos taurus (Bovine) AA Sequence: DDPQSSWDRVKDFATVYVEAIKDSGRDYVAQFEASALGKQLNLKLLDNWDTLASTLSKVREQLGPVTQEFWDNLEKETASLRQEMHKDLEEVKQKVQPYLDEFQKKWHEEVEIYRQKVAPLGEEFREGARQKVQELQDKLSPLAQELRDRARAHVETLRQQLAPYSDDLRQRLTARLEALKEGGGSLAEYHAKASEQLKALGEKAKPVLEDLRQGLLPVLESLKVSILAAIDEASKKLNAQ Expression Region: 25-265aa Sequence Info: FµLl Length Source: Yeast Tag Info: N-terminal 6xHis-tagged MW: 29.5 kDa Alternative Name(s): Apolipoprotein A1 Relevance: Participates in the reverse transport of cholesterol from tissues to the liver for excretion by promoting cholesterol efflux from tissues and by acting as a cofactor for the lecithin cholesterol acyltransferase (LCAT). As part of the SPAP complex, activates spermatozoa motility. Reference: Characterization and amino-terminal sequence of apolipoprotein AI from plasma high density lipoproteins in the preruminant calf, Bos spp.Auboiron S., Sparrow D.A., Beaubatie L., Bauchart D., Sparrow J.T., Laplaud M.P., Chapman J.M.Biochem. Biophys. Res. Commun. 166:833-839(1990) Purity: Greater than 90% as determined by SDS-PAGE. Storage Buffer: Tris-based buffer，50% glycerol Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.