ELISA Recombinant Bovine Angiogenin-1(ANG1)
Quantity: 200µg. Other Quantitys are also available. Please Inquire.
In Stock: No
Lead time: 10-20 working days
Research Topic: Others
Uniprot ID: P10152
Gene Names: ANG1
Organism: Bos taurus (Bovine)
AA Sequence: AQDDYRYIHFLTQHYDAKPKGRNDEYCFNMMKNRRLTRPCKDRNTFIHGNKNDIKAICEDRNGQPYRGDLRISKSEFQITICKHKGGSSRPPCRYGATEDSRVIVVGCENGLPVHFDESFITPRH
Expression Region: 24-148aa
Sequence Info: FµLl Length
Source: E.coli
Tag Info: N-terminal 6xHis-tagged
MW: 18.6 kDa
Alternative Name(s):
Relevance: Binds to actin on the surface of endothelial cells; once bound, angiogenin is endocytosed and translocated to the nucleus. StimµLates ribosomal RNA synthesis including that containing the initiation site sequences of 45S rRNA. Cleaves tRNA within anticodon loops to produce tRNA-derived stress-induced fragments (tiRNAs) which inhibit protein synthesis and triggers the assbly of stress granµLes (SGs) Angiogenin induces vascµLarization of normal and malignant tissues. Angiogenic activity is regµLated by interaction with RNH1 in vivo. Has very low ribonuclease activity.
Reference: Solution structure of bovine angiogenin by 1H nuclear magnetic resonance spectroscopy.Lequin O., Albaret C., Bontems F., Spik G., Lallemand J.-Y.Biochemistry 35:8870-8880(1996)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer,50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Our latest content
Check out what's new in our company !
Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.