ELISA Recombinant Bovine Odorant-binding protein
Quantity: 20µg. Other Quantitys are also available. Please Inquire.
In Stock: No
Lead time: 15-25 working days
Research Topic: Others
Uniprot ID: P07435
Gene Names: N/A
Organism: Bos taurus (Bovine)
AA Sequence: AQEEEAEQNLSELSGPWRTVYIGSTNPEKIQENGPFRTYFRELVFDDEKGTVDFYFSVKRDGKWKNVHVKATKQDDGTYVADYEGQNVFKIVSLSRTHLVAHNINVDKHGQTTELTELFVKLNVEDEDLEKFWKLTEDKGIDKKNVVNFLENEDHPHPE
Expression Region: 1-159aa
Sequence Info: FµLl Length
Source: Mammalian cell
Tag Info: N-terminal 10xHis-tagged
MW: 22 kDa
Alternative Name(s): Olfactory mucosa pyrazine-binding protein
Relevance: This protein binds a wide variety of chemical odorants.
Reference: "Three-dimensional structure and active site of three hydrophobic molecµLe-binding proteins with significant amino acid sequence similarity." Monaco H.L., Zanotti G. Biopolymers 32:457-465(1992)
Purity: Greater than 85% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer,50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
                            
                            
                            Our latest content
Check out what's new in our company !
                                Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.