ELISA Recombinant Bovine Lingual antimicrobial peptide(LAP)

Quantity: 200µg. Other Quantitys are also available. Please Inquire. In Stock: No Lead time: 10-20 working days Research Topic: Others Uniprot ID: Q28880 Gene Names: LAP Organism: Bos taurus (Bovine) AA Sequence: VRNSQSCRRNKGICVPIRCPGSMRQIGTCLGAQVKCCRRK Expression Region: 25-64aa Sequence Info: FµLl Length Source: E.coli Tag Info: N-terminal 6xHis-SUMO-tagged MW: 20.5 kDa Alternative Name(s): Leucine aminopeptidase 3 ;LAP-3Leucyl aminopeptidasePeptidase SProline aminopeptidase (EC:3.4.11.5)Prolyl aminopeptidase Relevance: Presumably involved in the processing and regµLar turnover of intracellµLar proteins. Catalyzes the roval of unsubstituted N-terminal amino acids from various peptides. Reference: The genome sequence of taurine cattle a window to ruminant biology and evolution.The bovine genome sequencing and analysis consortiumScience 324:522-528(2009) Purity: Greater than 90% as determined by SDS-PAGE. Storage Buffer: Tris-based buffer，50% glycerol Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.