ELISA Recombinant Bovine viral diarrhea virus Genome polyprotein,partial
Quantity:20µg. Other Quantitys are also available. For further information, please contact us.
Research Areas:Others
Uniprot ID:Q01499
Gene Names:N/A
Organism:Bovine viral diarrhea virus (strain SD-1) (BVDV) (Mucosal disease virus)
AA Sequence:MELITNELLYKTYKQKPVGVEEPVYDQAGNPLFGERGAIHPQSTLKLPHKRGERNVPTSLASLPKRGDCRSGNSKGPVSGIYLKPGPLFYQDYKGPVYHRAPLELFEEGSMCETTKRIGRVTGSDGKLYHIYICIDGCITVKSATRSHQRVLRWVHNRLDCPLWVTSC
Expression Region:1-168aa
Sequence Info:Partial
Source:E.coli
Tag Info:N-terminal 10xHis-tagged
MW:25.0 kDa
Alternative Name(s):Genome polyprotein [Cleaved into: N-terminal protease; N-pro; EC 3.4.22.-; Autoprotease p20); Capsid protein C; E(rns) glycoprotein; gp44/48); Envelope glycoprotein E1; gp33); Envelope glycoprotein E2; gp55); p7; Non-structural protein 2-3; Cysteine protease NS2; EC 3.4.22.-; Non-structural protein 2); Serine protease NS3; EC 3.4.21.113; EC 3.6.1.15; EC 3.6.4.13; Non-structural protein 3); Non-structural protein 4A; NS4A); Non-structural protein 4B; NS4B); Non-structural protein 5A; NS5A); RNA-directed RNA polymerase; EC 2.7.7.48; NS5B)]
Relevance:Initial binding to target cell probably involves interaction of E with glycosaminoglycans. E1 and/or E2 are responsible of cell attachment with CD46 and subsequent fusion after internalization of the virion by endocytosis.P7 forms a leader sequence to properly orient NS2 in the membrane.Uncleaved NS2-3 is required for production of infectious virus.NS2 protease seems to play a vital role in viral RNA replication control and in the pathogenicity of the virus.NS3 displays three enzymatic activities: serine protease, NTPase and RNA helicase.NS4A is a cofactor for the NS3 protease activity.RNA-directed RNA polymerase NS5 replicates the viral (+) and (-) genome.
Reference:"Structure of a pestivirus envelope glycoprotein E2 clarifies its role in cell entry." El Omari K., Iourin O., Harlos K., Grimes J.M., Stuart D.I. Cell Rep 3:30-35(2013)
Purity:Greater than 85% as determined by SDS-PAGE.
Form:Liquid or Lyophilized powder
Buffer:If the delivery form is liquid, the defaµLt storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution:We recommend that this vial be briefly centrifµged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our defaµLt final concentration of glycerol is 50%. Customers coµLd use it as reference.
Storage:The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Function:
Involvement in disease:
SubcellµLar Location:
Protein Families:
Tissue Specificity:
Paythway:
HGNC Database Link:
UniGene Database Link:
KEGG Database Link:
STRING Database Link:
OMIM Database Link:
Lead Time Guidance:3-7 business days
Our latest content
Check out what's new in our company !
Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.