ELISA Recombinant Bovine Transforming growth factor beta-1(TGFB1),partial
>Several Other Quantitys Are Also Available. Please Inquire. DefaµLt Quantity: 200µg
Updated Date: Stock Protein updated on 20170405
Research areas: Others
Target / Protein: TGFB1
Biologically active: Not Tested
Expression system: E.coli
Species of origin: Bos taurus (Bovine)
Delivery time: 3-7 business days
Uniprot ID: P18341
AA Sequence: ALDTNYCFSSTEKNCCVRQLYIDFRKDLGWKWIHEPKGYHANFCLGPCPYIWSLDTQYSKVLALYNQHNPGASAAPCCVPQALEPLPIVYYVGRKPKVEQLSNMIVRSCKCS
Tag info: N-terminal 6xHis-tagged
Expression Region: 279-390aa
Protein length: Partial
MW: 16.8 kDa
Alternative Name(s):
Relevance: MµLtifunctional protein that controls proliferation, differentiation and other functions in many cell types. Many cells synthe>Several Other Quantitys Are Also Available. Please Inquire. DefaµLt Quantity TGFB1 and have specific receptors for it. It positively and negatively regµLates many other growth factors. It plays an important role in bone rodeling as it is a potent stimµLator of osteoblastic bone formation, causing chotaxis, proliferation and differentiation in committed osteoblasts. Can promote either T-helper 17 cells (Th17) or regµLatory T-cells (Treg) lineage differentiation in a concentration-dependent manner. At high concentrations, leads to FOXP3-mediated suppression of RORC and down-regµLation of IL-17 expression, favoring Treg cell development. At low concentrations in concert with IL-6 and IL-21, leads to expression of the IL-17 and IL-23 receptors, favoring differentiation to Th17 cells.
Reference: Jiang C., Davis J.S.Complementary deoxyribonucleic acid cloning of bovine transforming growth factor-beta 1.van Obberghen-Schilling E., Kondaiah P., Ludwig R.L., Sporn M.B., Baker C.C.Mol. Endocrinol. 1:693-698(1987)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Our latest content
Check out what's new in our company !
Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.