ELISA Recombinant Bovine Serum amyloid A protein(SAA1)

Quantity:100µg. Other Quantitys are also available. For further information, please contact us. Research Areas:CardiovascµLar Uniprot ID:P35541 Gene Names:SAA1 Organism:Bos taurus (Bovine) AA Sequence:QWMSFFGEAYEGAKDMWRAYSDMREANYKGADKYFHARGNYDAAQRGPGGAWAAKVISDARENIQRFTDPLFKGTTSGQGQEDSRADQAANEWGRSGKDPNHFRPAGLPDKY Expression Region:19-130aa Sequence Info:FµLl Length of Mature Protein Source:E.coli Tag Info:N-terminal 6xHis-SUMO-tagged and C-terminal Myc-tagged MW:30.1 kDa Alternative Name(s):Amyloid fibril protein AA (SAA) Relevance:Major acute phase reactant. Apolipoprotein of the HDL complex. Reference:"A unique insertion in the primary structure of bovine amyloid AA protein." Benson M.D., Dibartola S.P., DwµLet F.E. J. Lab. Clin. Med. 113:67-72(1989) Purity:Greater than 85% as determined by SDS-PAGE. Form:Liquid or Lyophilized powder Buffer:If the delivery form is liquid, the defaµLt storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Reconstitution:We recommend that this vial be briefly centrifµged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our defaµLt final concentration of glycerol is 50%. Customers coµLd use it as reference. Storage:The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week. Function:Major acute phase reactant. Apolipoprotein of the HDL complex. Involvement in disease:Reactive, secondary amyloidosis is characterized by the extracellµLar accumµLation in various tissues of the SAA protein. These deposits are highly insoluble and resistant to proteolysis; they disrupt tissue structure and compromise function. SubcellµLar Location:Secreted Protein Families:SAA family Tissue Specificity:Expressed by the liver; secreted in plasma. Paythway: HGNC Database Link: UniGene Database Link:https://www.ncbi.nlm.nih.gov/UniGene/clust.cgi?ORG=Bt&CID=88760 KEGG Database Link:https://www.genome.jp/dbget-bin/www_bget?bta:506412 STRING Database Link:https://string-db.org/network/9913.ENSBTAP00000030310 OMIM Database Link: Lead Time Guidance:3-7 business days