ELISA Recombinant Bovine Rhodopsin(RHO),partial

Quantity:100µg. Other Quantitys are also available. For further information, please contact us. Research Areas:Signal Transduction Uniprot ID:P02699 Gene Names:RHO Organism:Bos taurus (Bovine) AA Sequence:MNGTEGPNFYVPFSNKTGVVRSPFEAPQYYLAEPWQ Expression Region:1-36aa Sequence Info:Partial Source:E.coli Tag Info:N-terminal 6xHis-KSI-tagged MW:19.5 kDa Alternative Name(s):RHO; Rhodopsin Relevance:Photoreceptor required for image-forming vision at low light intensity. Required for photoreceptor cell viability after birth (By similarity). Light-induced isomerization of 11-cis to all-trans retinal triggers a conformational change that activates signaling via G-proteins. Reference:"Rhodopsin and bacteriorhodopsin: structure-function relationships." Ovchinnikov Y.A. FEBS Lett. 148:179-191(1982) Purity:Greater than 85% as determined by SDS-PAGE. Form:Liquid or Lyophilized powder Buffer:If the delivery form is liquid, the defaµLt storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Reconstitution:We recommend that this vial be briefly centrifµged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our defaµLt final concentration of glycerol is 50%. Customers coµLd use it as reference. Storage:The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week. Function: Involvement in disease: SubcellµLar Location: Protein Families: Tissue Specificity: Paythway: HGNC Database Link: UniGene Database Link: KEGG Database Link: STRING Database Link: OMIM Database Link: Lead Time Guidance:3-7 business days