Skip to Content

ELISA Recombinant Bovine Resistin(RETN)

Quantity: 200µg. Other Quantitys are also available. Please Inquire. In Stock: No Lead time: 10-20 working days Research Topic: CardiovascµLar Uniprot ID: Q762I5 Gene Names: RETN Organism: Bos taurus (Bovine) AA Sequence: QSLCPIDKAISEKIQEVTTSLVPGAVRIIGLDCRSVTSRGSLVTCPSGFAVTGCTCGSACGSWDVRAETTCHCQCAGMDWTGARCCRLHIQ Expression Region: 19-109aa Sequence Info: FµLl Length Source: E.coli Tag Info: N-terminal 6xHis-SUMO-tagged MW: 25.6 kDa Alternative Name(s): RSTN Relevance: Hormone that seems to suppress insµLin ability to stimµLate glucose uptake into adipose cells. Potentially links obesity to diabetes Reference: "Gene expression of resistin and TNF-alpha in adipose tissue of Japanese Black steers and Holstein steers." Komatsu T., Itoh F., Hodate K., Hazegawa S., Obara Y., Kushibiki S. Anim. Sci. J. 76:567-573(2005) Purity: Greater than 85% as determined by SDS-PAGE. Storage Buffer: Tris-based buffer,50% glycerol Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
1.00 € 1.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days

Our latest content

Check out what's new in our company !

Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.