ELISA Recombinant Bovine Lutropin subunit beta(LHB)

Quantity: 200µg. Other Quantitys are also available. Please Inquire. In Stock: No Lead time: 10-20 working days Research Topic: Others Uniprot ID: P04651 Gene Names: LHB Organism: Bos taurus (Bovine) AA Sequence: SRGPLRPLCQPINATLAAEKEACPVCITFTTSICAGYCPSMKRVLPVILPPMPQRVCTYHELRFASVRLPGCPPGVDPMVSFPVALSCHCGPCRLSSTDCGGPRTQPLACDHPPLPDILFL Expression Region: 21-141aa Sequence Info: FµLl Length Source: E.coli Tag Info: N-terminal 6xHis-tagged MW: 17 kDa Alternative Name(s): Luteinizing hormone subunit beta ;LH-B ;LSH-B ;LSH-beta;Lutropin beta chain Relevance: Promotes spermatogenesis and ovµLation by stimµLating the testes and ovaries to syntheQuantity steroids. Reference: The gene for the beta subunit of bovine luteinizing hormone encodes a gonadotropin mRNA with an unusually short 5'-untranslated region.Virgin J.B., Silver B.J., Thomason A.R., Nilson J.H.J. Biol. Chem. 260:7072-7077(1985) Purity: Greater than 90% as determined by SDS-PAGE. Storage Buffer: Tris-based buffer，50% glycerol Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.