ELISA Recombinant Bovine Inter-alpha-trypsin inhibitor heavy chain H2(ITIH2)

Quantity:100µg. Other Quantitys are also available. For further information, please contact us. Research Areas:Cell Biology Uniprot ID:P56651 Gene Names:ITIH2 Organism:Bos taurus (Bovine) AA Sequence:LHYQEVKWRKLGSYEHRLHLKPGRLAKHELEVFNGYFVHFPAPENMIPIG Expression Region:1-50aa Sequence Info:FµLl Length Source:E.coli Tag Info:N-terminal 6xHis-KSI-tagged MW:21.3 kDa Alternative Name(s):/ Relevance:May act as a carrier of hyaluronan in serum or as a binding protein between hyaluronan and other matrix protein, including those on cell surfaces in tissues to regµLate the localization, synthesis and degradation of hyaluronan which are essential to cells undergoing biological processes. Reference:"A serum-derived hyaluronan-associated protein (SHAP) is the heavy chain of the inter alpha-trypsin inhibitor." Huang L., Yoneda M., Kimata K. J. Biol. Chem. 268:26725-26730(1993) Purity:Greater than 85% as determined by SDS-PAGE. Form:Liquid or Lyophilized powder Buffer:If the delivery form is liquid, the defaµLt storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Reconstitution:We recommend that this vial be briefly centrifµged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our defaµLt final concentration of glycerol is 50%. Customers coµLd use it as reference. Storage:The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week. Function: Involvement in disease: SubcellµLar Location: Protein Families: Tissue Specificity: Paythway: HGNC Database Link: UniGene Database Link: KEGG Database Link: STRING Database Link: OMIM Database Link: Lead Time Guidance:3-7 business days