ELISA Recombinant Bovine Guanine nucleotide-binding protein G(t) subunit alpha-2(GNAT2)

Quantity: 200µg. Other Quantitys are also available. Please Inquire. In Stock: Yes Lead time: 3-7 working days Research Topic: Neuroscience Uniprot ID: P04696 Gene Names: GNAT2 Organism: Bos taurus (Bovine) AA Sequence: GSGASAEDKELAKRSKELEKKLQEDADKEAKTVKLLLLGAGESGKSTIVKQMKIIHQDGYSPEECLEYKAIIYGNVLQSILAIIRAMPTLGIDYAEVSCVDNGRQLNNLADSIEEGTMPPELVEVIRKLWKDGGVQACFDRAAEYQLNDSASYYLNQLDRITAPDYLPNEQDVLRSRVKTTGIIETKFSVKDLNFRMFDVGGQRSERKKWIHCFEGVTCIIFCAALSAYDMVLVEDDEVNRMHESLHLFNSICNHKFFAATSIVLFLNKKDLFEEKIKKVHLSICFPEYDGNNSYEDAGNYIKSQFLDLNMRKDVKEIYSHMTCATDTQNVKFVFDAVTDIIIKENLKDCGLF Expression Region: 2-354aa Sequence Info: FµLl Length of Mature Protein Source: E.coli Tag Info: N-terminal 6xHis-tagged MW: 44 kDa Alternative Name(s): Transducin alpha-2 chain Relevance: Guanine nucleotide-binding proteins (G proteins) are involved as modµLators or transducers in various transmembrane signaling systems. Transducin is an amplifier and one of the transducers of a visual impµLse that performs the coupling between rhodopsin and cGMP-phosphodiesterase. Reference: "Sequence of the alpha subunit of photoreceptor G protein: homologies between transducin, ras, and elongation factors." Lochrie M.A., Hurley J.B., Simon M.I. Science 228:96-99(1985) Purity: Greater than 85% as determined by SDS-PAGE. Storage Buffer: Tris-based buffer，50% glycerol Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.