ELISA Recombinant Bovine Guanine nucleotide-binding protein G(t) subunit alpha-2(GNAT2)

>Several Other Quantitys Are Also Available. Please Inquire. DefaµLt Quantity: 200µg Updated Date: Stock Protein updated on 20171228 Research areas: Neuroscience Target / Protein: GNAT2 Biologically active: Not Tested Expression system: E.coli Species of origin: Bos taurus (Bovine) Delivery time: 3-7 business days Uniprot ID: P04696 AA Sequence: GSGASAEDKELAKRSKELEKKLQEDADKEAKTVKLLLLGAGESGKSTIVKQMKIIHQDGYSPEECLEYKAIIYGNVLQSILAIIRAMPTLGIDYAEVSCVDNGRQLNNLADSIEEGTMPPELVEVIRKLWKDGGVQACFDRAAEYQLNDSASYYLNQLDRITAPDYLPNEQDVLRSRVKTTGIIETKFSVKDLNFRMFDVGGQRSERKKWIHCFEGVTCIIFCAALSAYDMVLVEDDEVNRMHESLHLFNSICNHKFFAATSIVLFLNKKDLFEEKIKKVHLSICFPEYDGNNSYEDAGNYIKSQFLDLNMRKDVKEIYSHMTCATDTQNVKFVFDAVTDIIIKENLKDCGLF Tag info: N-terminal 6xHis-tagged Expression Region: 2-354aa Protein length: FµLl Length of Mature Protein MW: 44.0 kDa Alternative Name(s): Transducin alpha-2 chain Relevance: Guanine nucleotide-binding proteins (G proteins) are involved as modµLators or transducers in various transmembrane signaling systems. Transducin is an amplifier and one of the transducers of a visual impµLse that performs the coupling between rhodopsin and cGMP-phosphodiesterase. Reference: "Sequence of the alpha subunit of photoreceptor G protein: homologies between transducin, ras, and elongation factors." Lochrie M.A., Hurley J.B., Simon M.I. Science 228:96-99(1985) Purity: Greater than 85% as determined by SDS-PAGE. Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.