ELISA Recombinant Bovine Apolipoprotein A-I(APOA1),partial

Quantity:100µg. Other Quantitys are also available. For further information, please contact us. Research Areas:CardiovascµLar Uniprot ID:P15497 Gene Names:APOA1 Organism:Bos taurus (Bovine) AA Sequence:DDPQSSWDRVKDFATVYVEAIKDSGRDYVAQFEASALGKQLNLKLLDNWDTLASTLSKVREQLGPVTQEFWDNLEKETASLRQEMHKDLEEVKQKVQPYLDEFQKKWHEEVEIYRQKVAPLGEEFREGARQKVQELQDKLSPLAQELRDRARAHVETLRQQLAPYSDDLRQRLTARLEALKEGGGSLAEYHAKASEQLKALGEKAKPVLEDLRQGLLPVLESLKVSILAAIDEASKKLNAQ Expression Region:25-265aa Sequence Info:Partial Source:E.coli Tag Info:N-terminal 6xHis-B2M-tagged MW:41.5 Alternative Name(s):Apolipoprotein A1 (Apo-AI) (ApoA-I) Relevance:Participates in the reverse transport of cholesterol from tissues to the liver for excretion by promoting cholesterol efflux from tissues and by acting as a cofactor for the lecithin cholesterol acyltransferase. As part of the SPAP complex, activates spermatozoa motility. Reference:"Carboxyl terminus of apolipoprotein A-I (ApoA-I) is necessary for the transport of lipid-free ApoA-I but not prelipidated ApoA-I particles throµgh aortic endothelial cells." Ohnsorg P.M., Rohrer L., Perisa D., Kateifides A., Chroni A., Kardassis D., Zannis V.I., von Eckardstein A. J. Biol. Chem. 286:7744-7754(2011) Purity:Greater than 85% as determined by SDS-PAGE. Form:Liquid or Lyophilized powder Buffer:If the delivery form is liquid, the defaµLt storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Reconstitution:We recommend that this vial be briefly centrifµged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our defaµLt final concentration of glycerol is 50%. Customers coµLd use it as reference. Storage:The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week. Function:Participates in the reverse transport of cholesterol from tissues to the liver for excretion by promoting cholesterol efflux from tissues and by acting as a cofactor for the lecithin cholesterol acyltransferase (LCAT). As part of the SPAP complex, activates spermatozoa motility. Involvement in disease: SubcellµLar Location:Secreted Protein Families:Apolipoprotein A1/A4/E family Tissue Specificity:Major protein of plasma HDL, also found in chylomicrons. Paythway: HGNC Database Link: UniGene Database Link:https://www.ncbi.nlm.nih.gov/UniGene/clust.cgi?ORG=Bt&CID=49157 KEGG Database Link:https://www.genome.jp/dbget-bin/www_bget?bta:281631 STRING Database Link:https://string-db.org/network/9913.ENSBTAP00000002914 OMIM Database Link: Lead Time Guidance:13-23 business days