ELISA Recombinant Bovine Apolipoprotein A-I(APOA1),partial
Quantity:100µg. Other Quantitys are also available. For further information, please contact us.
Research Areas:CardiovascµLar
Uniprot ID:P15497
Gene Names:APOA1
Organism:Bos taurus (Bovine)
AA Sequence:DDPQSSWDRVKDFATVYVEAIKDSGRDYVAQFEASALGKQLNLKLLDNWDTLASTLSKVREQLGPVTQEFWDNLEKETASLRQEMHKDLEEVKQKVQPYLDEFQKKWHEEVEIYRQKVAPLGEEFREGARQKVQELQDKLSPLAQELRDRARAHVETLRQQLAPYSDDLRQRLTARLEALKEGGGSLAEYHAKASEQLKALGEKAKPVLEDLRQGLLPVLESLKVSILAAIDEASKKLNAQ
Expression Region:25-265aa
Sequence Info:Partial
Source:E.coli
Tag Info:N-terminal 6xHis-B2M-tagged
MW:41.5
Alternative Name(s):Apolipoprotein A1 (Apo-AI) (ApoA-I)
Relevance:Participates in the reverse transport of cholesterol from tissues to the liver for excretion by promoting cholesterol efflux from tissues and by acting as a cofactor for the lecithin cholesterol acyltransferase. As part of the SPAP complex, activates spermatozoa motility.
Reference:"Carboxyl terminus of apolipoprotein A-I (ApoA-I) is necessary for the transport of lipid-free ApoA-I but not prelipidated ApoA-I particles throµgh aortic endothelial cells." Ohnsorg P.M., Rohrer L., Perisa D., Kateifides A., Chroni A., Kardassis D., Zannis V.I., von Eckardstein A. J. Biol. Chem. 286:7744-7754(2011)
Purity:Greater than 85% as determined by SDS-PAGE.
Form:Liquid or Lyophilized powder
Buffer:If the delivery form is liquid, the defaµLt storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution:We recommend that this vial be briefly centrifµged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our defaµLt final concentration of glycerol is 50%. Customers coµLd use it as reference.
Storage:The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Function:Participates in the reverse transport of cholesterol from tissues to the liver for excretion by promoting cholesterol efflux from tissues and by acting as a cofactor for the lecithin cholesterol acyltransferase (LCAT). As part of the SPAP complex, activates spermatozoa motility.
Involvement in disease:
SubcellµLar Location:Secreted
Protein Families:Apolipoprotein A1/A4/E family
Tissue Specificity:Major protein of plasma HDL, also found in chylomicrons.
Paythway:
HGNC Database Link:
UniGene Database Link:https://www.ncbi.nlm.nih.gov/UniGene/clust.cgi?ORG=Bt&CID=49157
KEGG Database Link:https://www.genome.jp/dbget-bin/www_bget?bta:281631
STRING Database Link:https://string-db.org/network/9913.ENSBTAP00000002914
OMIM Database Link:
Lead Time Guidance:13-23 business days
                            
                            
                            Our latest content
Check out what's new in our company !
                                Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.