ELISA Recombinant Bovine Chloride intracellular channel protein 4(CLIC4)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Bos taurus (Bovine) Uniprot NO.:Q9XSA7 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:ALSMPLNGLKEEDKEPIIELFVKAGSDGESIGNCPFSQRLFMILWLKGVVFSVTTVDLKR KPADLQNLAPGTHPPFITFNNEVKTDVNKIEEFLEEVLCPPKYLKLSPKHPESNTAGMDI FAKFSAYIKNSRPEANEALERGLLKTLQKLDEYLNSPLPDEIDENSMEDIKFSTRKFLDG NEMTLADCNLLPKLHIVKVVAKKYRNFDIPKGMTGIWRYLTNAYSRDEFTNTCPSDKEVE IAYSDVAKRLTK Protein Names:Recommended name: Chloride intracellµLar channel protein 4 Alternative name(s): IntracellµLar chloride ion channel protein p64H1 Gene Names:Name:CLIC4 Expression Region:2-253 Sequence Info:fµLl length protein