Skip to Content

ELISA Recombinant Bovine coronavirus Hemagglutinin-esterase(HE)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Bovine coronavirus (strain Ontario) (BCoV) (BCV) Uniprot NO.:Q9DR81 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:FDNPPTNVVSHLNGDWFLFGDSRSDCNHVVTTNPRNYSYMDLNPALCGSGKISSKAGNSI FRSFHFTDFYNYTGEGQQIIFYEGVNFTPYHAFKCTTSGSNDIWMQNKGLFYTQVYKNMA VYRSLTFVNVPYVYNGSAQSTALCKSGSLVLNNPAYIAREANFGDYYYKVEADFYLSGCD EYIVPLCIFNGKFLSNTKYYDDSQYYFNKDTGVIYGLNSTETITTGFDFNCHYLVLPSGN YLAISNELLLTVPTKAICLNKRKDFTPVQVVDSRWNNARQSDNMTAVACQPPYCYFRNST TNYVGVYDINHGDAGFTSILSGLLYDSPCFSQQGVFRYDNVSSVWPLYPYGRCPTAADIN TPDVPICVYDPLPIIFLGILLGVAVIIIVVLLLYFMVDNGTRLHDA Protein Names:Recommended name: Hemagglutinin-esterase Short name= HE protein EC= 3.1.1.53 Alternative name(s): E3 glycoprotein Gene Names:Name:HE ORF Names:2b Expression Region:19-424 Sequence Info:fµLl length protein
1.00 € 1.00 €

This combination does not exist.

Our latest content

Check out what's new in our company !

Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.