ELISA Recombinant Bovine Short transient receptor potential channel 6(TRPC6)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Bos taurus (Bovine) Uniprot NO.:Q9MYW0 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:IFIMVFVAFMIGMFNLYSYYIGAKQNEAFTTVEESFKTLFWAIFGLSEVKSVVINYNHKF IENIGYVLYGVYNVTMVIVLLNmLIAMIN Protein Names:Recommended name: Short transient receptor potential channel 6 Short name= TrpC6 Gene Names:Name:TRPC6 Synonyms:TRP6 Expression Region:1-89 Sequence Info:fµLl length protein