ELISA Recombinant Bovine Fetal and adult testis-expressed transcript protein homolog(FATE1)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Bos taurus (Bovine) Uniprot NO.:Q95LA0 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MAGGAVPNLKEKMQVPKDEDLLLGSFRDNQECSVAAEMKEHMSRLLGASQRRQRVDPKAV GSAVVWNTAANQSKKMGPQLRGVGVVGEQGDGGAQPQENPGGSQGMRSQFERRELNTLAE IGLEELNELEMEIMRRQLFMITERLRYLEDQSATWHQREVLLFTmLLSSCITNLWLWMRQ Protein Names:Recommended name: Fetal and adµLt testis-expressed transcript protein homolog Gene Names:Name:FATE1 Synonyms:FATE Expression Region:1-180 Sequence Info:fµLl length protein