ELISA Recombinant Bovine Lysosomal-associated transmembrane protein 4A(LAPTM4A)
Quantity:50 µg. Other Quantitys are also available.
Product Type:Recombinant Protein
Species:Bos taurus (Bovine)
Uniprot NO.:Q6QRN8
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MVSMTFKRSRSDRFYSTRCCGCCHVRTGTIILGTWYMVVNLLMAILLTVEVTHPNSMPAV NIQYEVIGNYYSSERMADNACVLFAVSVLMFIISSmLVYGAISYQVGWLIPFFCYRLFDF VLSCLVAISSLTYLPRIKEYLDQLPDFPYKDDLLALDSSCLLFIVLVFFALFIIFKAYLI NCVWNCYKYINNRNMPEIAVYPAFEAPPQYVLPTYEMAVKMPEKEPPPPYIPA
Protein Names:Recommended name: Lysosomal-associated transmembrane protein 4A
Gene Names:Name:LAPTM4A
Expression Region:1-233
Sequence Info:fµLl length protein
                            
                            
                            Our latest content
Check out what's new in our company !
                                Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.