ELISA Recombinant Bovine Interferon alpha-inducible protein 6(IFI6)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Bos taurus (Bovine) Uniprot NO.:Q6IED8 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:CCEEEDEKRYSEENSDSSFWGMVTYMAVGGGLMAAALPmLGFASTGIAANSLASSLMSWS AVANGGGVPAGGLVATLQSLGASGGSALMAKIGAFLGYTVHKQVESRQKESKEKK Protein Names:Recommended name: Interferon alpha-inducible protein 6 Alternative name(s): Interferon-induced protein 6-16 Short name= Ifi-6-16 Gene Names:Name:IFI6 Expression Region:20-134 Sequence Info:fµLl length protein