ELISA Recombinant Bovine herpesvirus 1.1 Glycoprotein N(gN)
Quantity:50 µg. Other Quantitys are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Bovine herpesvirus 1.1 (strain Cooper) (BoHV-1) (Infectious bovine rhinotracheitis virus)
Uniprot NO.:Q77CE4
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:RDPLLDAMRREGAMDFWSAGCYARGVPLSEPPQALVVFYVALTAVMVAVALYAYGLCFRL MGASGPNKKESRGRG
Protein Names:Recommended name: Glycoprotein N Short name= gN
Gene Names:Name:gN ORF Names:µL49.5
Expression Region:22-96
Sequence Info:fµLl length protein
                            
                            
                            Our latest content
Check out what's new in our company !
                                Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.