ELISA Recombinant Bovine Vitamin K epoxide reductase complex subunit 1(VKORC1)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Bos taurus (Bovine) Uniprot NO.:Q6B4J2 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MGATWRSPGWVRLALCLAGLVLSLYALHVKAARARDRDYRALCDVGTAISCSRVFSSRWG RGFGLVEHVLGKDSILNQSNSIFGCIFYTLQLLLGCLQGRWASVLLRLSCLVSLAGSVYL AWILFFVLYDFCIVCITTYAINVGLTVLSFREVQGPQGKVKGH Protein Names:Recommended name: Vitamin K epoxide reductase complex subunit 1 EC= 1.1.4.1 Alternative name(s): Vitamin K1 2,3-epoxide reductase subunit 1 Gene Names:Name:VKORC1 Expression Region:1-163 Sequence Info:fµLl length protein