ELISA Recombinant Brucella abortus biovar 1 Protein CrcB homolog 2(crcB2)
Quantity:50 µg. Other Quantitys are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Brucella abortus biovar 1 (strain 9-941)
Uniprot NO.:Q57CD6
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MTPLDVMWVCLGGGVGSLGRWWIGRIVGEYHHGAFPLGTFLINISGAFVIGYLSVLFGVD WHDRYGTmLNAGVLTGILGGYTTFSSMQLDAVKLSHKGQGGLAVFYLVASVLSGLFAAWL GAmLAHLQG
Protein Names:Recommended name: Protein CrcB homolog 2
Gene Names:Name:crcB2 Ordered Locus Names:BruAb1_1367
Expression Region:1-129
Sequence Info:fµLl length protein