ELISA Recombinant Brucella abortus biovar 1 Protein CrcB homolog 2(crcB2)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Brucella abortus biovar 1 (strain 9-941) Uniprot NO.:Q57CD6 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MTPLDVMWVCLGGGVGSLGRWWIGRIVGEYHHGAFPLGTFLINISGAFVIGYLSVLFGVD WHDRYGTmLNAGVLTGILGGYTTFSSMQLDAVKLSHKGQGGLAVFYLVASVLSGLFAAWL GAmLAHLQG Protein Names:Recommended name: Protein CrcB homolog 2 Gene Names:Name:crcB2 Ordered Locus Names:BruAb1_1367 Expression Region:1-129 Sequence Info:fµLl length protein