ELISA Recombinant Brucella abortus biovar 1 Prolipoprotein diacylglyceryl transferase(lgt)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Brucella abortus biovar 1 (strain 9-941) Uniprot NO.:Q57BY9 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MIETLLPASALAFPAIDPVIFRVGPLAVHWYGLGYVVGILFAWWYGKKLLRSHRLWANNQ PPMAPEALDDFVIWAALGVVLGGRIGYVLFYNFSYYISNPLAIPALWDGGMSFHGGILGT TLAMILFARSRGILVWSMFDTIAAGVPIGLGVVRVANFINSELWGRVSDVPWAVYFPNGG PLPRHPSQLYEAFLEGLVLFFVLFVLVWGARKLKQPGFVAGAFVTGYGLSRIAVEFFREP DAQIGYLFGGWLTMGMVLSVPMVLLGLWAMWRANRAAARNA Protein Names:Recommended name: Prolipoprotein diacylglyceryl transferase EC= 2.4.99.- Gene Names:Name:lgt Ordered Locus Names:BruAb1_1517 Expression Region:1-281 Sequence Info:fµLl length protein