ELISA Recombinant Bovine Gap junction beta-6 protein(GJB6)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Bos taurus (Bovine) Uniprot NO.:Q5E9Z5 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MDWGTLHTFVGGVNKHSTSIGKVWVTVLFVFRVMILVVAAQEVWGDEQEDFVCNTLQPGC RNVCYDHFFPVSHIRLWALQLIFVSTPALLVAMHVAYYRHEAARRFRRGETRSEFKDLED IKRQKVRIEGSLWWTYTSSIFFRIVFEAAFMYVFYFLYNGYHLPWVLKCGIQPCPNLVDC FISRPTEKTVFTIFMISASVICmLLNVAELCYLLLKVCFRRSKRAQTQKAPPNHALKESK QNEMNELISEGGQNAITGFPS Protein Names:Recommended name: Gap junction beta-6 protein Gene Names:Name:GJB6 Expression Region:1-261 Sequence Info:fµLl length protein