ELISA Recombinant Bovine PRA1 family protein 3(ARL6IP5)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Bos taurus (Bovine) Uniprot NO.:Q5E9M1 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MDVNIAPLRAWDDFFPGSDRFARPDFRDISKWNNRVVSNLLYYQTNYLVVAAMMISVVGF LSPFNMILGGIVVVLVFTGFVWAAHNKDILRRMKKQYPTAFVMVVmLASYFLISLFGGVM VFVFGITFPLLLMFIHASLRLRNLKNKLENKMEEIGLKRTPMGIVLDALEQQEETITKFS DYISKMKE Protein Names:Recommended name: PRA1 family protein 3 Alternative name(s): ADP-ribosylation factor-like protein 6-interacting protein 5 Short name= ARL-6-interacting protein 5 Short name= Aip-5 Gene Names:Name:ARL6IP5 Synonyms:PRAF3 Expression Region:1-188 Sequence Info:fµLl length protein