ELISA Recombinant Bovine Sphingosine 1-phosphate receptor 1(S1PR1)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Bos taurus (Bovine) Uniprot NO.:Q5E9P3 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MGSTRIPLVKALHSPVSDYVNYDIIVRHYNYTGKLKISADKDNGIKLISVVFILICCFII LENIFVLLTIWKTKKFHRPMYYFIGNLALSDLLAGVAYTANLLLSGATTYKLTPAQWFLR EGSMFVALSASVFSLLAIAIERYITmLKMKLHNGSNRFRSFLLISACWVISLILGGLPIM GWNCISTLPSCSTVLPLYHKHYILFCTTVFTLLLLSIVILYCRIYSLVRTRSRRLTFRKN ISKASRSSEKSLALLKTVIIVLGVFIACWAPLFILLLLDVGCKVKTCDILFRTEYFLVLA VLNSGTNPIIYTLSNKEMRRAFVRIMSCCKCPSRDSASKFTRPIIAGMEFSRSKSDNSSH PQKDDGDNPETIMSSGNVNSSS Protein Names:Recommended name: Sphingosine 1-phosphate receptor 1 Short name= S1P receptor 1 Short name= S1P1 Alternative name(s): Endothelial differentiation G-protein coupled receptor 1 Sphingosine 1-phosphate receptor Edg-1 Short name= Gene Names:Name:S1PR1 Synonyms:EDG1 Expression Region:1-382 Sequence Info:fµLl length protein