ELISA Recombinant Bovine Trans-2,3-enoyl-CoA reductase(TECR)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Bos taurus (Bovine) Uniprot NO.:Q3ZCD7 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MKHYEVEILDAKTREKLCFLDKVEPQATIAEIKNLFTKTHPQWYPARQSLRLDPKGKSLK DEDVLQKLPVGTTATLYFRDLGAQISWVTVFLTEYAGPLFIYLLFYFRVPFIYGRKYDFT SSRHTVVHLACICHSFHYIKRLLETLFVHRFSHGTMPLRNIFKNCTYYWGFAAWMAYYIN HPLYTPPTYGAQQVKLALAIFVICQLGNFSIHMALRDLRPAGSKTRKIPYPTRNPFTWLF LLVSCPNYTYEVGSWIGFAIMTQCLPVALFSLVGFTQMTIWAKGKHRSYLKEFRDYPPLR MPIIPFLL Protein Names:Recommended name: Trans-2,3-enoyl-CoA reductase Short name= TER EC= 1.3.1.38 Alternative name(s): Synaptic glycoprotein SC2 Gene Names:Name:TECR Synonyms:GPSN2 Expression Region:1-308 Sequence Info:fµLl length protein