Skip to Content

ELISA Recombinant Bovine DNA damage-regulated autophagy modulator protein 2(DRAM2)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Bos taurus (Bovine) Uniprot NO.:Q3ZC48 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MWWFQQGLSFLPSALVIWTAAAFIFSYITAITLHHVDPVLPYISDTGTVAPEKCLFGAmL NIAAVLCVATIYVRYKQVHALNPEENRIIRLNKAGLVLGLLSCLGLSLVANFQKTTFFAV HVCGAVLTFGMGSLYMFVQTILSYQMQPKIHGKQVFWIRLLLVIWCGVSAFSmLTCSSLL YNGSFGADIVQKLHWNPEDKGYVLHMITTAAEWSMSLSFFGFFLTYIRDFQKISLRVEAT LHGLTLYDTAPCPVNNERTWLLSRDV Protein Names:Recommended name: DNA damage-regµLated autophagy modµLator protein 2 Alternative name(s): Transmembrane protein 77 Gene Names:Name:DRAM2 Synonyms:TMEM77 Expression Region:1-266 Sequence Info:fµLl length protein
1.00 € 1.00 €

This combination does not exist.

Our latest content

Check out what's new in our company !

Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.