ELISA Recombinant Bovine Nuclear envelope phosphatase-regulatory subunit 1(CNEP1R1)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Bos taurus (Bovine) Uniprot NO.:Q3ZBP2 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MNSLEQAEDLKAFERRLTEYIHCLQPATGRWRmLLIVVSVCTATGAWNWLIDPETQKVSF FTSLWNHPFFTISCITLIGLFFAGIHKRVVAPSIIAARCRTVLAEYNMSCDDTGKLILKP RPHVQ Protein Names:Recommended name: Nuclear envelope phosphatase-regµLatory subunit 1 Alternative name(s): Transmembrane protein 188 Gene Names:Name:CNEP1R1 Synonyms:TMEM188 Expression Region:1-125 Sequence Info:fµLl length protein