ELISA Recombinant Bovine Motile sperm domain-containing protein 3(MOSPD3)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Bos taurus (Bovine) Uniprot NO.:Q3T033 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MRRGAPQDQELVGPGAPGRGSRGAPPPSGPVVPVLVFPPDLVFRADQRSGPRQLLTLYNP TGAVLRFRVLCTAPAKYTVFDAEGYVKPQSCIDIVIRHVAPHPRNYDVQDRFRIELSEEG TEGRVVGRKDITSVLRAPAYPLELQGQSDPTPHPEPHSWTASSTAQPFPENPHPQLATSS FLLFLLMGTVSVAFLLLPLQDELGSQLPQILHVSLGQKLVAAYVLGLLTMVFLRT Protein Names:Recommended name: Motile sperm domain-containing protein 3 Gene Names:Name:MOSPD3 Expression Region:1-235 Sequence Info:fµLl length protein