ELISA Recombinant Bovine Lipid phosphate phosphohydrolase 3(PPAP2B)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Bos taurus (Bovine) Uniprot NO.:Q3SZE3 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MQNYKYDKAIVAESKNGGSPALNNNPRKGGSKRVLLICLDLFCLFMAGLPFIIIETSTIK PYHRGFYCNDESIKYPQKTGETINDAVLTAVGIVIAILAIITGEFYRIYYLKEKSRSTIQ NPYVAALYKQVGCFLFGCAISQSFTDIAKVSIGRLRPHFLNVCNPDFSQINCSVGYIQNY RCRGEDSKVQEARKSFFSGHASFSMYTmLYLVLYLQARFTWRGARLLRPLLQFTLIMMAF YTGLSRVSDHKHHPSDVLAGFAQGALVACCIVFFVSDLFKTKTTLSLPPSAIRKDmLSPV DIDRSNHHNMV Protein Names:Recommended name: Lipid phosphate phosphohydrolase 3 EC= 3.1.3.4 Alternative name(s): PAP2-beta Phosphatidate phosphohydrolase type 2b Phosphatidic acid phosphatase 2b Short name= PAP-2b Short name= PAP2b Gene Names:Name:PPAP2B Expression Region:1-311 Sequence Info:fµLl length protein