Skip to Content

ELISA Recombinant Bovine Trans-2,3-enoyl-CoA reductase-like(TECRL)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Bos taurus (Bovine) Uniprot NO.:Q3SZ89 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MFKRHKSLASERRRELISRGATRSILKDDMKNFHFLSQFILSAGPLKSTSAVKHSKTIHF EIEILDAQTKKQICIVDKVTQKSTIHDVKQKFHKACPQWYPSRVGLQLERGGPFLKDNLT IQSVAASSIVTLYFTDLGQQVSWTTVFLAEYTGPLLIYLLFYLRIPYIYNMKESSRRLCH PVVHLACFCHCIHYIRYLLETLFVHKVSSGHTSLKNLLKSCAFYWGFTSWIAYYINHPRY TPPSFGYRQVAISAINFLICEAGNHFINVVLSHPSHTGNNACFPSPNYNPFTWMFFLVSC PNYTYEIGSWISFTIMTQTLPVGIFTLLMSIQMSLWAKKKHKIYLKKFSSYMHRKSAMIP FIL Protein Names:Recommended name: Trans-2,3-enoyl-CoA reductase-like EC= 1.3.1.- Alternative name(s): Steroid 5-alpha-reductase 2-like 2 protein Gene Names:Name:TECRL Synonyms:SRD5A2L2 Expression Region:1-363 Sequence Info:fµLl length protein
1.00 € 1.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days

Our latest content

Check out what's new in our company !

Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.