ELISA Recombinant Bovine Translocon-associated protein subunit gamma(SSR3)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Bos taurus (Bovine) Uniprot NO.:Q3SZ87 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MAPKGGPKQQSEEDLLLQDFSRNLSAKSSALFFGNAFIVSAIPIWLYWRIWHMDLIQSAV LYSVMTLVSTYLVAFAYKNVKFVLKHKVAQKREDAVSKEVTRKLSEADNRKMSRKEKDER ILWKKNEVADYEATTFSIFYNNTLFLVLVIVASFFILKNFNPTVNYILSISASSGLIALL STGSK Protein Names:Recommended name: Translocon-associated protein subunit gamma Short name= TRAP-gamma Alternative name(s): Signal sequence receptor subunit gamma Short name= SSR-gamma Gene Names:Name:SSR3 Expression Region:1-185 Sequence Info:fµLl length protein