ELISA Recombinant Bovine Lysoplasmalogenase(TMEM86B)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Bos taurus (Bovine) Uniprot NO.:Q3T0W0 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MDARKEGLLRKPRFSAQPRVGMGLLPFFLACAVYLLVRNADQPPWVNVLLKILPVLYLAG FLGTAHPGGGYRALLQGALLCSAVGDACLVWPEALRYGMAAFGLAHLLYLRAFGLTPLKP GLLLPLLLVSALYFRVLHPHMPPQVVWPLLAYSIVLVAmLWRGLARGGSAHWGALLFVLS DSVLAWNIFTYLVPHGHLLVMTTYYSAQmLITLSAFQNPRLKSH Protein Names:Recommended name: Lysoplasmalogenase EC= 3.3.2.2 EC= 3.3.2.5 Alternative name(s): Transmembrane protein 86B Gene Names:Name:TMEM86B Expression Region:1-224 Sequence Info:fµLl length protein