ELISA Recombinant Bovine ADP-ribosylation factor-like protein 6-interacting protein 6(ARL6IP6)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Bos taurus (Bovine) Uniprot NO.:Q3MHM8 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MSFVESGRRSAPLRRRPGTPVPFARPAYSVFSQGDSWGEGEVEEEEGCDQVARDLRAEFS AGSSSKLRKDPVLQPDGDGSPVLPDKRNGIFSADAGGKALARRWPVQVLSILCSLLFAIL LACLLAITYLIVKELHAENLKNEDDVNTGLLGFWSLLIISLTAGFSCCSFSWTVTYFDSF EPGMFPPTPLSPARFKKMTGHSFHMGYSMAILNGIVAALTVAWCLM Protein Names:Recommended name: ADP-ribosylation factor-like protein 6-interacting protein 6 Short name= ARL-6-interacting protein 6 Short name= Aip-6 Gene Names:Name:ARL6IP6 Expression Region:1-226 Sequence Info:fµLl length protein