ELISA Recombinant Bovine Tetraspanin-6(TSPAN6)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Bos taurus (Bovine) Uniprot NO.:Q32KU6 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MASPSRRLQTKPVITCFKSVLLIYTFIFWITGVILLAVGIWGKVSLENYFSLLNEKATNV PFVLIGTGTVIILLGTFGCFATCRASAWmLKLYAMFLTLIFLVELVAAIIGFVFRHEIKN SLKNNYEKALKQYNATGDYRSDAVDKIQSmLHCCGVTNYRDWKDTNYYSEKGFPESCCKL EDCSPQRDADKVNNEGCFIMVMTIIESEMGVVAGISFGVACFQLIGIFLAYCLSRAITNN QYEIV Protein Names:Recommended name: Tetraspanin-6 Short name= Tspan-6 Gene Names:Name:TSPAN6 Expression Region:1-245 Sequence Info:fµLl length protein