ELISA Recombinant Bovine Peptidyl-prolyl cis-trans isomerase FKBP11(FKBP11)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Bos taurus (Bovine) Uniprot NO.:Q2YDL5 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:GSETESPVRTLQVETLVEPPEPCAEPATFGDTLHIHYSGSLVDGRIFDTSLTRDPLVIEL GQKQVIPGLEQSLLDMCVGEKRRVIIPSHLAYGKRGFPPSIPADAELHFDVELIALIRAN YWQKLVKGILPLVGMAMVPALLGLIGYHLYRKASSPKISKNKLKEEKRNKSKKK Protein Names:Recommended name: Peptidyl-prolyl cis-trans isomerase FKBP11 Short name= PPIase FKBP11 EC= 5.2.1.8 Alternative name(s): FK506-binding protein 11 Short name= FKBP-11 Rotamase Gene Names:Name:FKBP11 Expression Region:30-203 Sequence Info:fµLl length protein