Skip to Content

ELISA Recombinant Brucella abortus Putative peptide permease protein BAB2_0815(BAB2_0815)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Brucella abortus (strain 2308) Uniprot NO.:Q2YK65 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MRSSIHASRLRKMGQSIPASTGPMARSANRFLQNRAAIFGLVLLTPLLFAVLTYPLWLPY KPNDIDLMAMNSAPSWKHWFGTDGVGRDVFARTMEGGRISLLVAVSSVVLSTAIGFLIGA ISALGGRWADAIAMRSVDLAMTLPPVIFLLVLASIIGSGIWSTVVVIALLSWPVLSRMIR ARLLELREREFVMASRGMGAGLGHLLFRHGLPNSIDILVVYATLQVANAILLEAGLSFLG LGVPPPAASWSNmLNAARSTAVLEQFPWQWLFPGGALVLAVLAINFIGDGLRDAFDPRAE LN Protein Names:Recommended name: Putative peptide permease protein BAB2_0815 Gene Names:Ordered Locus Names:BAB2_0815 Expression Region:1-302 Sequence Info:fµLl length protein
1.00 € 1.00 €

This combination does not exist.

Our latest content

Check out what's new in our company !

Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.