ELISA Recombinant Bovine ADP-ATP translocase 4(SLC25A31)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Bos taurus (Bovine) Uniprot NO.:Q2YDD9 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MQREPPKRKQEKKVEKGLFDATSFGKDLLAGGVAAAVSKTTVAPIERVKLLLQVQASSKQ ISPEAQYKGIVDCLVRIPREQGFLSYWRGNLANVIRYFPTQALNFAFKDKYKQLFMSGVN KEKQFWRWFLANLASGGAAGATSLCVVYPLDFARTRLGADIGKGPEERQFKGLGDCIMKI AKSDGIVGLYQGFGVSVQGIIVYRASYFGAYDTVKGLLPKPKETHFLVSFFIAQVVTTCS GILSYPFDTVRRRMMMQSGEAERQYKGTLDCFMKIYQQEGIGAFFRGAFSNILRGTGGAL VLVLYDKIKDLLNIDIGGSSSGD Protein Names:Recommended name: ADP/ATP translocase 4 Alternative name(s): ADP,ATP carrier protein 4 Adenine nucleotide translocator 4 Short name= ANT 4 Solute carrier family 25 member 31 Gene Names:Name:SLC25A31 Expression Region:1-323 Sequence Info:fµLl length protein