ELISA Recombinant Brucella abortus Putative peptide transport system permease protein BAB2_1051(BAB2_1051)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Brucella abortus (strain 2308) Uniprot NO.:Q2YJK0 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MTELASPTSFSMPDIGKSPVVLTARRLMRHRSFRIGLVLLLIVVLAAVLAPWITNGKPNA TSVRMRFQPPGLEHLFGTDNFGRDLWTRVLYGAQVSLWIGLTVAVLSAILGAIIGIAAAW YRRFDTLLMRVMDALMAFPAILLAIGISAALGPHLSSVIIALTSAYIPRCARIVRASALV LRETDYVDAARLAGASDLRIITRHILPNCLAPLLVTLTFVFAYAILAEATLSFLGIGTPP PHASWGSIVAQGRDYSVDAWWImLFPGIAITISALAINLIGDGLRDVLDPRLKMEG Protein Names:Recommended name: Putative peptide transport system permease protein BAB2_1051 Gene Names:Ordered Locus Names:BAB2_1051 Expression Region:1-296 Sequence Info:fµLl length protein