ELISA Recombinant Bovine Vesicle transport protein GOT1B(GOLT1B)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Bos taurus (Bovine) Uniprot NO.:Q2YDE3 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MISLTDTQKIGMGLTGFGVFFLFFGMILFFDKALLAIGNVLFVAGLAFVIGLERTFRFFF QKHKMKATGFFLGGVFVVLIGWPLIGMIFEIYGFFLLFRGFFPVVVGFIRRVPVLGSLLN LPGIRSFVDKVGESNNMV Protein Names:Recommended name: Vesicle transport protein GOT1B Alternative name(s): Golgi transport 1 homolog B Gene Names:Name:GOLT1B Expression Region:1-138 Sequence Info:fµLl length protein