ELISA Recombinant Brucella abortus Phosphatidate cytidylyltransferase(cdsA)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Brucella abortus (strain 2308) Uniprot NO.:Q2YRP9 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MSNLQTRIITAIVLGTITLWLTWVGGVGFTLFSIAIGLAMFYEWTELSATRQTAFSRLFG WAWLIVTGILLILDRGALLTIGFLVAGCAILLVTQWKSGRGWPAAGLFYAGFSALSLSLL RGDEPFGFTTIVFLFAVVWSTDITAYFNGRALGGPKLAPRFSPNKTWSGAIGGAAAAVAG GLLVASLVAAPGGWGVPVLALLLSIVSQIGDLAESWVKRQFGAKDSGRLLPGHGGVLDRV DGLVAAAALLYLFGAIFAEPDVLSAIFFSF Protein Names:Recommended name: Phosphatidate cytidylyltransferase EC= 2.7.7.41 Alternative name(s): CDP-DAG synthase CDP-DG synthase CDP-diacylglycerol synthase Short name= CDS CDP-diglyceride pyrophosphorylase CDP-diglyceride syn Gene Names:Name:cdsA Ordered Locus Names:BAB1_1179 Expression Region:1-270 Sequence Info:fµLl length protein