ELISA Recombinant Bovine V-type proton ATPase 21 kDa proteolipid subunit(ATP6V0B)
Quantity:50 µg. Other Quantitys are also available.
Product Type:Recombinant Protein
Species:Bos taurus (Bovine)
Uniprot NO.:Q2TA24
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MTGLVLLYSGVFVAFWACLLVVGICYTIFDLGFRFDVAWFLTETSPFMWSNLGIGLAISL SVVGAAWGIYITGSSIIGGGVKAPRIKTKNLVSIIFCEAVAIYGIIMAIVISNMAEPFSA TDPKAIGHRNYHAGYSMFGAGLTVGLSNLFCGVCVGIVGSGAALADAQNPSLFVKILIVE IFGSAIGLFGVIVAILQTSRVKMGD
Protein Names:Recommended name: V-type proton ATPase 21 kDa proteolipid subunit Short name= V-ATPase 21 kDa proteolipid subunit Alternative name(s): Vacuolar proton pump 21 kDa proteolipid subunit
Gene Names:Name:ATP6V0B
Expression Region:1-205
Sequence Info:fµLl length protein
Our latest content
Check out what's new in our company !
Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.