ELISA Recombinant Bovine UPF0694 transmembrane protein C14orf109 homolog

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Bos taurus (Bovine) Uniprot NO.:Q2HJ69 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MPKPPDYSELSDSLTLAVGTGRFSGPLHRAWRMMNFRQRMGWIGVGLYLLASAAAFYYVF EINETYNRLALEHIQQHPEEPLEGTTWTHSLKTRLLSLPFWFWTVVFLIPYLQMFLFLYS CTRADPKTVGYCIIPICLAVICNRHQAFVKASNQISRLQLIDT Protein Names:Recommended name: UPF0694 transmembrane protein C14orf109 homolog Gene Names: Expression Region:1-163 Sequence Info:fµLl length protein